PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10014569
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 278aa    MW: 31827.5 Da    PI: 6.1267
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10014569genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.1e-121461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  l + +   G ++W+ +++  g+ R++k+c++rw +yl
      Lus10014569 14 RGPWTIEEDHMLMNFIFNNGIHCWRMVPKLAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding51.81.8e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T+ E+ + ++++ +lG++ W++Ia++++ gRt++++k++w++
      Lus10014569  67 RGAFTEAEENQMIQLHCRLGNR-WSKIASHLP-GRTDNEVKNHWNT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-20564IPR009057Homeodomain-like
PROSITE profilePS5129412.578961IPR017930Myb domain
SuperFamilySSF466897.86E-2811108IPR009057Homeodomain-like
SMARTSM007175.5E-61363IPR001005SANT/Myb domain
PfamPF002492.0E-101461IPR001005SANT/Myb domain
CDDcd001679.10E-51661No hitNo description
PROSITE profilePS5129425.06562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-2565116IPR009057Homeodomain-like
SMARTSM007175.9E-1466114IPR001005SANT/Myb domain
PfamPF002499.6E-1567110IPR001005SANT/Myb domain
CDDcd001673.72E-1069110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGRQPCCEKV GLKRGPWTIE EDHMLMNFIF NNGIHCWRMV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGAF TEAEENQMIQ LHCRLGNRWS KIASHLPGRT DNEVKNHWNT RIKKELKLAG  120
VDPVTHQPIL DNKNIEGGDQ DDQKKQKYLE EELELSTTTK LDEITTINDD LVRRDYQVCG  180
GSSLEYFGGH NKSSNTSTTS QGSTISSSIE ESNSHNDYNY HRGNHEPALV SNTQLDDYDT  240
MKQWVDGVDS SMFSWDDGFM NGNLDDDFFL HGKWALL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033365.11e-92PREDICTED: myb-related protein 315
TrEMBLA0A059AG382e-93A0A059AG38_EUCGR; Uncharacterized protein
STRINGPOPTR_0001s36220.15e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66253150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.16e-78myb domain protein 40